PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G135100.1.p
Common NameSb06g021480, SORBIDRAFT_06g021480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family CO-like
Protein Properties Length: 330aa    MW: 34595.6 Da    PI: 5.2701
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G135100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.27.1e-082056437
              zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg....H 37
                          r C+ ++ + ++l+C+ +  +lC+ C    H g    H
  Sobic.006G135100.1.p 20 RPCDACGAEAARLYCRADAAFLCAGCDARAH-GagsrH 56
                          68*************************9999.435667 PP

2zf-B_box23.11.5e-0759103341
              zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                            + C+ +e+ ++   C+ +   lC++C   +H+       H++ p
  Sobic.006G135100.1.p  59 VWLCEVCEHAPAAVTCRADAAALCASCDADIHSAnplarrHERLP 103
                           679*****************************6688888898877 PP

3CCT70.15.7e-24242285144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Sobic.006G135100.1.p 242 REARLMRYREKRKSRRFEKTIRYASRKAYAETRPRIKGRFAKRT 285
                           9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.7E-81761IPR000315B-box-type zinc finger
PROSITE profilePS5011910.5231761IPR000315B-box-type zinc finger
PfamPF006435.8E-62056IPR000315B-box-type zinc finger
CDDcd000217.91E-92061No hitNo description
PROSITE profilePS5011910.4857104IPR000315B-box-type zinc finger
PfamPF006437.1E-659104IPR000315B-box-type zinc finger
CDDcd000213.52E-860104No hitNo description
SMARTSM003363.7E-962104IPR000315B-box-type zinc finger
PROSITE profilePS5101716.876242284IPR010402CCT domain
PfamPF062039.3E-18242284IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEGDEKSAGG APAYWGLGAR PCDACGAEAA RLYCRADAAF LCAGCDARAH GAGSRHARVW  60
LCEVCEHAPA AVTCRADAAA LCASCDADIH SANPLARRHE RLPVAPFFGA LADAPKPFAS  120
SAAAVPPKAT AGADDDGSSE AEAASWLLPE PDHGHKEEGA TTEVFFADSD PYLDLDFARS  180
MDDIKTIGVQ GGPPELDLNG AKLFYSDHSM NHSVSSSEAA VVPDAAAGAA PVVAVVSRGL  240
EREARLMRYR EKRKSRRFEK TIRYASRKAY AETRPRIKGR FAKRTPGAGE DPLEEHEEMY  300
SSAAAAVAAL MAPGGADADY GVDGVVPTY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278420.0KJ727842.1 Zea mays clone pUT5886 C2C2-CO-like transcription factor (COL11) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446734.10.0hypothetical protein SORBIDRAFT_06g021480
TrEMBLC5YBH30.0C5YBH3_SORBI; Putative uncharacterized protein Sb06g021480
STRINGSb06g021480.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.14e-21CONSTANS-like 5